PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00000710001
Common NameGSBRNA2T00000710001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 197aa    MW: 21849.6 Da    PI: 10.0485
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00000710001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.72.9e-393392261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +++lkcprC+s+ntkfCyynnyslsqPr+fCkaCrryWt+GGalrnvP+Ggg+rk kks
  GSBRNA2T00000710001 33 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKACRRYWTRGGALRNVPIGGGCRKTKKS 92
                         57899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.5E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4973791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253991IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHRTTGTP HTKKPPSSST SQDQQTLKCP RCNSSNTKFC YYNNYSLSQP  60
RHFCKACRRY WTRGGALRNV PIGGGCRKTK KSFKPNAVAT PSSSQRFFSS IMEDSSKFFP  120
PPTTMDFQLA GLSLNKINDL QLMNNQEVLG LRPMDQVETT PVDVGSGLSL MGFGDYSNNN  180
TIQRGRLQPP EQPTET*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00000710001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892661e-148AC189266.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB022L12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728157.11e-133PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL63e-99DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078F2N61e-145A0A078F2N6_BRANA; BnaA06g24490D protein
STRINGBra024399.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.15e-85Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]